APEH polyclonal antibody
  • APEH polyclonal antibody

APEH polyclonal antibody

Ref: AB-PAB22332
APEH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APEH.
Información adicional
Size 100 uL
Gene Name APEH
Gene Alias ACPH|APH|D3F15S2|D3S48E|DNF15S2|MGC2178|OPH
Gene Description N-acylaminoacyl-peptide hydrolase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APEH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 327
Iso type IgG

Enviar un mensaje


APEH polyclonal antibody

APEH polyclonal antibody