C6orf108 polyclonal antibody
  • C6orf108 polyclonal antibody

C6orf108 polyclonal antibody

Ref: AB-PAB22327
C6orf108 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf108.
Información adicional
Size 100 uL
Gene Name C6orf108
Gene Alias RCL|RP3-330M21.3|dJ330M21.3
Gene Description chromosome 6 open reading frame 108
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf108.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10591
Iso type IgG

Enviar un mensaje


C6orf108 polyclonal antibody

C6orf108 polyclonal antibody