ANKRD34A polyclonal antibody
  • ANKRD34A polyclonal antibody

ANKRD34A polyclonal antibody

Ref: AB-PAB22323
ANKRD34A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD34A.
Información adicional
Size 100 uL
Gene Name ANKRD34A
Gene Alias ANKRD34|DKFZp761F202
Gene Description ankyrin repeat domain 34A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD34A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284615
Iso type IgG

Enviar un mensaje


ANKRD34A polyclonal antibody

ANKRD34A polyclonal antibody