TYW3 polyclonal antibody
  • TYW3 polyclonal antibody

TYW3 polyclonal antibody

Ref: AB-PAB22321
TYW3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TYW3.
Información adicional
Size 100 uL
Gene Name TYW3
Gene Alias C1orf171|FLJ40918
Gene Description tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TYW3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127253
Iso type IgG

Enviar un mensaje


TYW3 polyclonal antibody

TYW3 polyclonal antibody