SLC35B2 polyclonal antibody
  • SLC35B2 polyclonal antibody

SLC35B2 polyclonal antibody

Ref: AB-PAB22320
SLC35B2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35B2.
Información adicional
Size 100 uL
Gene Name SLC35B2
Gene Alias PAPST1|SLL|UGTrel4
Gene Description solute carrier family 35, member B2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35B2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 347734
Iso type IgG

Enviar un mensaje


SLC35B2 polyclonal antibody

SLC35B2 polyclonal antibody