PSMB1 polyclonal antibody
  • PSMB1 polyclonal antibody

PSMB1 polyclonal antibody

Ref: AB-PAB22318
PSMB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMB1.
Información adicional
Size 100 uL
Gene Name PSMB1
Gene Alias FLJ25321|HC5|KIAA1838|PMSB1|PSC5
Gene Description proteasome (prosome, macropain) subunit, beta type, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5689
Iso type IgG

Enviar un mensaje


PSMB1 polyclonal antibody

PSMB1 polyclonal antibody