Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AIM1L polyclonal antibody
Abnova
AIM1L polyclonal antibody
Ref: AB-PAB22317
AIM1L polyclonal antibody
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against recombinant AIM1L.
Información adicional
Size
100 uL
Gene Name
AIM1L
Gene Alias
CRYBG2|DKFZp434L1713|FLJ10040|FLJ38020
Gene Description
absent in melanoma 1-like
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
IHC-P
Immunogen Prot. Seq
PEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRL
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human AIM1L.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
55057
Iso type
IgG
Enviar un mensaje
AIM1L polyclonal antibody
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*