AIM1L polyclonal antibody
  • AIM1L polyclonal antibody

AIM1L polyclonal antibody

Ref: AB-PAB22317
AIM1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AIM1L.
Información adicional
Size 100 uL
Gene Name AIM1L
Gene Alias CRYBG2|DKFZp434L1713|FLJ10040|FLJ38020
Gene Description absent in melanoma 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AIM1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55057
Iso type IgG

Enviar un mensaje


AIM1L polyclonal antibody

AIM1L polyclonal antibody