PHF20 polyclonal antibody
  • PHF20 polyclonal antibody

PHF20 polyclonal antibody

Ref: AB-PAB22313
PHF20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHF20.
Información adicional
Size 100 uL
Gene Name PHF20
Gene Alias C20orf104|FLJ33479|GLEA2|HCA58|NZF|TZP
Gene Description PHD finger protein 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHF20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51230
Iso type IgG

Enviar un mensaje


PHF20 polyclonal antibody

PHF20 polyclonal antibody