RANBP17 polyclonal antibody
  • RANBP17 polyclonal antibody

RANBP17 polyclonal antibody

Ref: AB-PAB22304
RANBP17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RANBP17.
Información adicional
Size 100 uL
Gene Name RANBP17
Gene Alias FLJ32916
Gene Description RAN binding protein 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDGELSCRVFQLISLMDTGLPRCCNEKIELAILWFLDQFRKTYVGDQLQRTSKVYARMSEVLGITDDNHVLETFMT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RANBP17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64901
Iso type IgG

Enviar un mensaje


RANBP17 polyclonal antibody

RANBP17 polyclonal antibody