ZNF789 polyclonal antibody
  • ZNF789 polyclonal antibody

ZNF789 polyclonal antibody

Ref: AB-PAB22297
ZNF789 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF789.
Información adicional
Size 100 uL
Gene Name ZNF789
Gene Alias -
Gene Description zinc finger protein 789
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGKPFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF789.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285989
Iso type IgG

Enviar un mensaje


ZNF789 polyclonal antibody

ZNF789 polyclonal antibody