C7orf43 polyclonal antibody
  • C7orf43 polyclonal antibody

C7orf43 polyclonal antibody

Ref: AB-PAB22293
C7orf43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf43.
Información adicional
Size 100 uL
Gene Name C7orf43
Gene Alias DKFZp761G0712|FLJ10925
Gene Description chromosome 7 open reading frame 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGCFPCPLNALE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55262
Iso type IgG

Enviar un mensaje


C7orf43 polyclonal antibody

C7orf43 polyclonal antibody