LRRC25 polyclonal antibody
  • LRRC25 polyclonal antibody

LRRC25 polyclonal antibody

Ref: AB-PAB22292
LRRC25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC25.
Información adicional
Size 100 uL
Gene Name LRRC25
Gene Alias FLJ38116|MAPA
Gene Description leucine rich repeat containing 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126364
Iso type IgG

Enviar un mensaje


LRRC25 polyclonal antibody

LRRC25 polyclonal antibody