GRAMD2 polyclonal antibody
  • GRAMD2 polyclonal antibody

GRAMD2 polyclonal antibody

Ref: AB-PAB22290
GRAMD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRAMD2.
Información adicional
Size 100 uL
Gene Name GRAMD2
Gene Alias -
Gene Description GRAM domain containing 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRAMD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196996
Iso type IgG

Enviar un mensaje


GRAMD2 polyclonal antibody

GRAMD2 polyclonal antibody