KIAA0240 polyclonal antibody
  • KIAA0240 polyclonal antibody

KIAA0240 polyclonal antibody

Ref: AB-PAB22276
KIAA0240 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0240.
Información adicional
Size 100 uL
Gene Name KIAA0240
Gene Alias DKFZp686P0250
Gene Description KIAA0240
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPNGNSLFGNSSSSPVAQPVTVPFNSTNFQTSLPVHNIIIQRGLAPNSNKVPINIQPKPIQMGQQNTYNVNNLGIQQHHVQQGISFASA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0240.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23506
Iso type IgG

Enviar un mensaje


KIAA0240 polyclonal antibody

KIAA0240 polyclonal antibody