ATP9B polyclonal antibody
  • ATP9B polyclonal antibody

ATP9B polyclonal antibody

Ref: AB-PAB22275
ATP9B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP9B.
Información adicional
Size 100 uL
Gene Name ATP9B
Gene Alias ATPASEP|ATPIIB|DKFZp686H2093|FLJ46612|HUSSY-20|MGC150650|MGC150651|MGC61572|NEO1L
Gene Description ATPase, class II, type 9B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATP9B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374868
Iso type IgG

Enviar un mensaje


ATP9B polyclonal antibody

ATP9B polyclonal antibody