SMG7 polyclonal antibody
  • SMG7 polyclonal antibody

SMG7 polyclonal antibody

Ref: AB-PAB22273
SMG7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMG7.
Información adicional
Size 100 uL
Gene Name SMG7
Gene Alias C1orf16|EST1C|FLJ23717|KIAA0250|SGA56M|SMG-7
Gene Description Smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMG7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9887
Iso type IgG

Enviar un mensaje


SMG7 polyclonal antibody

SMG7 polyclonal antibody