SNRNP200 polyclonal antibody
  • SNRNP200 polyclonal antibody

SNRNP200 polyclonal antibody

Ref: AB-PAB22269
SNRNP200 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNRNP200.
Información adicional
Size 100 uL
Gene Name SNRNP200
Gene Alias ASCC3L1|BRR2|HELIC2|U5-200KD
Gene Description small nuclear ribonucleoprotein 200kDa (U5)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNRNP200.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23020
Iso type IgG

Enviar un mensaje


SNRNP200 polyclonal antibody

SNRNP200 polyclonal antibody