SDCCAG3 polyclonal antibody
  • SDCCAG3 polyclonal antibody

SDCCAG3 polyclonal antibody

Ref: AB-PAB22267
SDCCAG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDCCAG3.
Información adicional
Size 100 uL
Gene Name SDCCAG3
Gene Alias NY-CO-3
Gene Description serologically defined colon cancer antigen 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDCCAG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10807
Iso type IgG

Enviar un mensaje


SDCCAG3 polyclonal antibody

SDCCAG3 polyclonal antibody