KIF13A polyclonal antibody
  • KIF13A polyclonal antibody

KIF13A polyclonal antibody

Ref: AB-PAB22265
KIF13A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF13A.
Información adicional
Size 100 uL
Gene Name KIF13A
Gene Alias FLJ27232|bA500C11.2
Gene Description kinesin family member 13A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITSGYFSHSASNATLSDMVVPSSDSSDQLAIQTKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIVVPLKENSALAKGSPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF13A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63971
Iso type IgG

Enviar un mensaje


KIF13A polyclonal antibody

KIF13A polyclonal antibody