SOBP polyclonal antibody
  • SOBP polyclonal antibody

SOBP polyclonal antibody

Ref: AB-PAB22261
SOBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SOBP.
Información adicional
Size 100 uL
Gene Name SOBP
Gene Alias FLJ10159|JXC1
Gene Description sine oculis binding protein homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SOBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55084
Iso type IgG

Enviar un mensaje


SOBP polyclonal antibody

SOBP polyclonal antibody