ZRANB1 polyclonal antibody
  • ZRANB1 polyclonal antibody

ZRANB1 polyclonal antibody

Ref: AB-PAB22258
ZRANB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZRANB1.
Información adicional
Size 100 uL
Gene Name ZRANB1
Gene Alias DKFZp762P2216|TRABID
Gene Description zinc finger, RAN-binding domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZRANB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54764
Iso type IgG

Enviar un mensaje


ZRANB1 polyclonal antibody

ZRANB1 polyclonal antibody