KCND2 polyclonal antibody
  • KCND2 polyclonal antibody

KCND2 polyclonal antibody

Ref: AB-PAB22245
KCND2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCND2.
Información adicional
Size 100 uL
Gene Name KCND2
Gene Alias KIAA1044|KV4.2|MGC119702|MGC119703|RK5
Gene Description potassium voltage-gated channel, Shal-related subfamily, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCND2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3751
Iso type IgG

Enviar un mensaje


KCND2 polyclonal antibody

KCND2 polyclonal antibody