KHDC1 polyclonal antibody
  • KHDC1 polyclonal antibody

KHDC1 polyclonal antibody

Ref: AB-PAB22239
KHDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KHDC1.
Información adicional
Size 100 uL
Gene Name KHDC1
Gene Alias C6orf148|MGC10818|NDG1|bA257K9.4
Gene Description KH homology domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KHDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80759
Iso type IgG

Enviar un mensaje


KHDC1 polyclonal antibody

KHDC1 polyclonal antibody