ZNF470 polyclonal antibody
  • ZNF470 polyclonal antibody

ZNF470 polyclonal antibody

Ref: AB-PAB22236
ZNF470 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF470.
Información adicional
Size 100 uL
Gene Name ZNF470
Gene Alias CZF-1|FLJ26175|FLJ26846
Gene Description zinc finger protein 470
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KDPWVIKGGMNRGLCPDLECVWVTKSLSLNQDIYEEKLPPAIIMERLKSYDLECSTLGKNWKCEDLFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF470.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388566
Iso type IgG

Enviar un mensaje


ZNF470 polyclonal antibody

ZNF470 polyclonal antibody