SAMD3 polyclonal antibody
  • SAMD3 polyclonal antibody

SAMD3 polyclonal antibody

Ref: AB-PAB22234
SAMD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAMD3.
Información adicional
Size 100 uL
Gene Name SAMD3
Gene Alias FLJ34563|MGC35163
Gene Description sterile alpha motif domain containing 3
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq WKRALKDRFKYVRRPIEDDEQVIRNKCKFGHRRGQTRKSLADIRFDEIKLVQIKEEAVCFDSELDEHIKWFQQEYVKTEKDWR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 154075
Iso type IgG

Enviar un mensaje


SAMD3 polyclonal antibody

SAMD3 polyclonal antibody