ZNF519 polyclonal antibody
  • ZNF519 polyclonal antibody

ZNF519 polyclonal antibody

Ref: AB-PAB22232
ZNF519 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF519.
Información adicional
Size 100 uL
Gene Name ZNF519
Gene Alias FLJ36809|FLJ42861|HsT2362
Gene Description zinc finger protein 519
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQDSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF519.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162655
Iso type IgG

Enviar un mensaje


ZNF519 polyclonal antibody

ZNF519 polyclonal antibody