APLP1 polyclonal antibody
  • APLP1 polyclonal antibody

APLP1 polyclonal antibody

Ref: AB-PAB22231
APLP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APLP1.
Información adicional
Size 100 uL
Gene Name APLP1
Gene Alias APLP
Gene Description amyloid beta (A4) precursor-like protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APLP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 333
Iso type IgG

Enviar un mensaje


APLP1 polyclonal antibody

APLP1 polyclonal antibody