RILPL2 polyclonal antibody
  • RILPL2 polyclonal antibody

RILPL2 polyclonal antibody

Ref: AB-PAB22230
RILPL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RILPL2.
Información adicional
Size 100 uL
Gene Name RILPL2
Gene Alias FLJ30380|FLJ32372|MGC7036
Gene Description Rab interacting lysosomal protein-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq EERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RILPL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196383
Iso type IgG

Enviar un mensaje


RILPL2 polyclonal antibody

RILPL2 polyclonal antibody