ARL4C polyclonal antibody
  • ARL4C polyclonal antibody

ARL4C polyclonal antibody

Ref: AB-PAB22227
ARL4C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARL4C.
Información adicional
Size 100 uL
Gene Name ARL4C
Gene Alias ARL7|LAK
Gene Description ADP-ribosylation factor-like 4C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IF
Immunogen Prot. Seq GIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARL4C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10123
Iso type IgG

Enviar un mensaje


ARL4C polyclonal antibody

ARL4C polyclonal antibody