SLC6A7 polyclonal antibody
  • SLC6A7 polyclonal antibody

SLC6A7 polyclonal antibody

Ref: AB-PAB22226
SLC6A7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC6A7.
Información adicional
Size 100 uL
Gene Name SLC6A7
Gene Alias PROT
Gene Description solute carrier family 6 (neurotransmitter transporter, L-proline), member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC6A7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6534
Iso type IgG

Enviar un mensaje


SLC6A7 polyclonal antibody

SLC6A7 polyclonal antibody