OR4K1 polyclonal antibody
  • OR4K1 polyclonal antibody

OR4K1 polyclonal antibody

Ref: AB-PAB22222
OR4K1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR4K1.
Información adicional
Size 100 uL
Gene Name OR4K1
Gene Alias OR14-19
Gene Description olfactory receptor, family 4, subfamily K, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OR4K1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79544
Iso type IgG

Enviar un mensaje


OR4K1 polyclonal antibody

OR4K1 polyclonal antibody