SLC10A4 polyclonal antibody
  • SLC10A4 polyclonal antibody

SLC10A4 polyclonal antibody

Ref: AB-PAB22220
SLC10A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC10A4.
Información adicional
Size 100 uL
Gene Name SLC10A4
Gene Alias MGC29802|P4
Gene Description solute carrier family 10 (sodium/bile acid cotransporter family), member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC10A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201780
Iso type IgG

Enviar un mensaje


SLC10A4 polyclonal antibody

SLC10A4 polyclonal antibody