PAN3 polyclonal antibody
  • PAN3 polyclonal antibody

PAN3 polyclonal antibody

Ref: AB-PAB22217
PAN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PAN3.
Información adicional
Size 100 uL
Gene Name PAN3
Gene Alias -
Gene Description PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PAN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255967
Iso type IgG

Enviar un mensaje


PAN3 polyclonal antibody

PAN3 polyclonal antibody