GOT1L1 polyclonal antibody
  • GOT1L1 polyclonal antibody

GOT1L1 polyclonal antibody

Ref: AB-PAB22216
GOT1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GOT1L1.
Información adicional
Size 100 uL
Gene Name GOT1L1
Gene Alias MGC33309
Gene Description glutamic-oxaloacetic transaminase 1-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YRVCMTNEGHPWVSLVVQKTRLQISQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GOT1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137362
Iso type IgG

Enviar un mensaje


GOT1L1 polyclonal antibody

GOT1L1 polyclonal antibody