GARNL3 polyclonal antibody
  • GARNL3 polyclonal antibody

GARNL3 polyclonal antibody

Ref: AB-PAB22214
GARNL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GARNL3.
Información adicional
Size 100 uL
Gene Name GARNL3
Gene Alias DKFZp434O131|DKFZp761J1523|FLJ38360|bA356B19.1
Gene Description GTPase activating Rap/RanGAP domain-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GARNL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84253
Iso type IgG

Enviar un mensaje


GARNL3 polyclonal antibody

GARNL3 polyclonal antibody