BPGM polyclonal antibody
  • BPGM polyclonal antibody

BPGM polyclonal antibody

Ref: AB-PAB22212
BPGM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BPGM.
Información adicional
Size 100 uL
Gene Name BPGM
Gene Alias -
Gene Description 2,3-bisphosphoglycerate mutase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BPGM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 669
Iso type IgG

Enviar un mensaje


BPGM polyclonal antibody

BPGM polyclonal antibody