ESPN polyclonal antibody
  • ESPN polyclonal antibody

ESPN polyclonal antibody

Ref: AB-PAB22204
ESPN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ESPN.
Información adicional
Size 100 uL
Gene Name ESPN
Gene Alias DFNB36|DKFZp434A196|DKFZp434G2126
Gene Description espin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ESPN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83715
Iso type IgG

Enviar un mensaje


ESPN polyclonal antibody

ESPN polyclonal antibody