BAT2D1 polyclonal antibody
  • BAT2D1 polyclonal antibody

BAT2D1 polyclonal antibody

Ref: AB-PAB22199
BAT2D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BAT2D1.
Información adicional
Size 100 uL
Gene Name BAT2D1
Gene Alias BAT2-iso|XTP2
Gene Description BAT2 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TTSQSSKQPPPSIRLPSAQTPNGTDYVASGKSIQTPQSHGTLTAELWDNKVAPPAVLNDISKKLGPISPPQPPSVSAWNKPLTSFGSAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BAT2D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23215
Iso type IgG

Enviar un mensaje


BAT2D1 polyclonal antibody

BAT2D1 polyclonal antibody