GPBP1L1 polyclonal antibody
  • GPBP1L1 polyclonal antibody

GPBP1L1 polyclonal antibody

Ref: AB-PAB22188
GPBP1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPBP1L1.
Información adicional
Size 100 uL
Gene Name GPBP1L1
Gene Alias RP11-767N6.1|SP192
Gene Description GC-rich promoter binding protein 1-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GMSQRSGGGTGNHRHWNGSFHSRKGCAFQEKPPMEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPSGVWENPPSAKQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPBP1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60313
Iso type IgG

Enviar un mensaje


GPBP1L1 polyclonal antibody

GPBP1L1 polyclonal antibody