ADAMTS9 polyclonal antibody
  • ADAMTS9 polyclonal antibody

ADAMTS9 polyclonal antibody

Ref: AB-PAB22185
ADAMTS9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ADAMTS9.
Información adicional
Size 100 uL
Gene Name ADAMTS9
Gene Alias FLJ42955|KIAA1312
Gene Description ADAM metallopeptidase with thrombospondin type 1 motif, 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ADAMTS9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56999
Iso type IgG

Enviar un mensaje


ADAMTS9 polyclonal antibody

ADAMTS9 polyclonal antibody