UBXN10 polyclonal antibody
  • UBXN10 polyclonal antibody

UBXN10 polyclonal antibody

Ref: AB-PAB22184
UBXN10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBXN10.
Información adicional
Size 100 uL
Gene Name UBXN10
Gene Alias FLJ25429|UBXD3
Gene Description UBX domain protein 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RFVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBXN10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127733
Iso type IgG

Enviar un mensaje


UBXN10 polyclonal antibody

UBXN10 polyclonal antibody