KIF26B polyclonal antibody
  • KIF26B polyclonal antibody

KIF26B polyclonal antibody

Ref: AB-PAB22181
KIF26B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF26B.
Información adicional
Size 100 uL
Gene Name KIF26B
Gene Alias FLJ10157|MGC35030
Gene Description kinesin family member 26B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GYIPMKTNITVYPCIAMSPRNIQEPEAPTATPKAGPTLAQSRESKENSAKKEMKFEDPWLKREEEVKKETAHPNEEGMMRCETATGPSNAETR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF26B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55083
Iso type IgG

Enviar un mensaje


KIF26B polyclonal antibody

KIF26B polyclonal antibody