HSPA6 polyclonal antibody
  • HSPA6 polyclonal antibody

HSPA6 polyclonal antibody

Ref: AB-PAB22178
HSPA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HSPA6.
Información adicional
Size 100 uL
Gene Name HSPA6
Gene Alias -
Gene Description heat shock 70kDa protein 6 (HSP70B')
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSPA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3310
Iso type IgG

Enviar un mensaje


HSPA6 polyclonal antibody

HSPA6 polyclonal antibody