TRIM11 polyclonal antibody
  • TRIM11 polyclonal antibody

TRIM11 polyclonal antibody

Ref: AB-PAB22174
TRIM11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIM11.
Información adicional
Size 100 uL
Gene Name TRIM11
Gene Alias BIA1|RNF92
Gene Description tripartite motif-containing 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIM11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81559
Iso type IgG

Enviar un mensaje


TRIM11 polyclonal antibody

TRIM11 polyclonal antibody