LUZP1 polyclonal antibody
  • LUZP1 polyclonal antibody

LUZP1 polyclonal antibody

Ref: AB-PAB22169
LUZP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LUZP1.
Información adicional
Size 100 uL
Gene Name LUZP1
Gene Alias FLJ35697|KIAA0601|LUZP
Gene Description leucine zipper protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LUZP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7798
Iso type IgG

Enviar un mensaje


LUZP1 polyclonal antibody

LUZP1 polyclonal antibody