FLAD1 polyclonal antibody
  • FLAD1 polyclonal antibody

FLAD1 polyclonal antibody

Ref: AB-PAB22164
FLAD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLAD1.
Información adicional
Size 100 uL
Gene Name FLAD1
Gene Alias FAD1|FADS|MGC31803|MGC40255|PP591|RP11-307C12.7
Gene Description FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLAD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80308
Iso type IgG

Enviar un mensaje


FLAD1 polyclonal antibody

FLAD1 polyclonal antibody