HEXIM2 polyclonal antibody
  • HEXIM2 polyclonal antibody

HEXIM2 polyclonal antibody

Ref: AB-PAB22156
HEXIM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEXIM2.
Información adicional
Size 100 uL
Gene Name HEXIM2
Gene Alias FLJ32384|L3
Gene Description hexamthylene bis-acetamide inducible 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEXIM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124790
Iso type IgG

Enviar un mensaje


HEXIM2 polyclonal antibody

HEXIM2 polyclonal antibody