FAM102B polyclonal antibody
  • FAM102B polyclonal antibody

FAM102B polyclonal antibody

Ref: AB-PAB22155
FAM102B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM102B.
Información adicional
Size 100 uL
Gene Name FAM102B
Gene Alias DKFZp686N01110|DKFZp779B126
Gene Description family with sequence similarity 102, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM102B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284611
Iso type IgG

Enviar un mensaje


FAM102B polyclonal antibody

FAM102B polyclonal antibody