YOD1 polyclonal antibody
  • YOD1 polyclonal antibody

YOD1 polyclonal antibody

Ref: AB-PAB22141
YOD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YOD1.
Información adicional
Size 100 uL
Gene Name YOD1
Gene Alias DKFZp451J1719|DUBA8|OTUD2|PRO0907
Gene Description YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YOD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55432
Iso type IgG

Enviar un mensaje


YOD1 polyclonal antibody

YOD1 polyclonal antibody