PLD5 polyclonal antibody
  • PLD5 polyclonal antibody

PLD5 polyclonal antibody

Ref: AB-PAB22138
PLD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLD5.
Información adicional
Size 100 uL
Gene Name PLD5
Gene Alias FLJ40773|MGC120565|MGC120566|MGC120567
Gene Description phospholipase D family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200150
Iso type IgG

Enviar un mensaje


PLD5 polyclonal antibody

PLD5 polyclonal antibody